PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F00420.1.p
Common NameEUGRSUZ_F00420, LOC104448025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 25355.9 Da    PI: 6.066
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F00420.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.86e-28959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+i+n + rqvtfskRr g++KKA ELSvLCdaevav+ifs tgkl+eyss
  Eucgr.F00420.1.p  9 KKIDNVTARQVTFSKRRRGLFKKAGELSVLCDAEVAVVIFSATGKLFEYSS 59
                      68***********************************************96 PP

2K-box42.42.9e-15891701798
             K-box  17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                        + +  +L ke+ +  + +R+l GedL+ L+++eLqqLe+ Le +l+++  +K+e ++++i +l  k  el eenk+L++ +
  Eucgr.F00420.1.p  89 EHSNNMRLSKEVAEKSHRLRQLRGEDLQGLNIEELQQLEKMLEAGLNRVLVTKEERIRTEITDLETKGAELIEENKMLKQTM 170
                       4444456777777777889***********************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.688161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-37160IPR002100Transcription factor, MADS-box
CDDcd002657.32E-40278No hitNo description
SuperFamilySSF554553.27E-31376IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.79886176IPR002487Transcription factor, K-box
PfamPF014868.3E-1492170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MAREKIKIKK IDNVTARQVT FSKRRRGLFK KAGELSVLCD AEVAVVIFSA TGKLFEYSSS  60
SMKDTLERYT LHHNNLENMD QPSLELQLEH SNNMRLSKEV AEKSHRLRQL RGEDLQGLNI  120
EELQQLEKML EAGLNRVLVT KEERIRTEIT DLETKGAELI EENKMLKQTM TTLTKGKRHI  180
VTEPDVALPE EGVSSESATN VCSCNSGPPL EDDGSDTSLK LGLPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-19180183Myocyte-specific enhancer factor 2B
1tqe_R4e-19180183Myocyte-specific enhancer factor 2B
1tqe_Q4e-19180183Myocyte-specific enhancer factor 2B
1tqe_P4e-19180183Myocyte-specific enhancer factor 2B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F00420.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010060099.11e-165PREDICTED: MADS-box protein SVP-like isoform X2
SwissprotQ9FUY62e-93JOIN_SOLLC; MADS-box protein JOINTLESS
SwissprotQ9FVC11e-93SVP_ARATH; MADS-box protein SVP
TrEMBLA0A059BL701e-164A0A059BL70_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g07460.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-89MIKC_MADS family protein